Brand:
Dragon Pharma, Europe
Manufacturer:
Dragon Pharma, Europe
Dosage Info:
<div class="tab-pane fade" id="offer-tabbody--dosage-and-usage" role="tabpanel">
<section class="tab-panel" id="panel-usage">
<h2>Dosage & Usage Guidelines</h2>
<p>Tesamorelin is administered via subcutaneous injection, typically once per day. Common dosages range from 1 mg to 2 mg daily, depending on treatment goals and body composition needs. The peptide is most effective when used in a fasted state, ideally before bedtime or early morning to sync with natural GH secretion peaks.</p>
<h3>Example Tesamorelin Cycle</h3>
<p>A typical cycle may run for 8–12 weeks with daily dosing:</p>
<ul>
<li><strong>Weeks 1–12:</strong> 1 mg daily, subcutaneously</li>
<li>Stacking with fat-loss peptides like <a href="https://www.dragonpharma.net/peptides-414/aod-9604-5mg-45663">AOD 9604</a> is common during body recomposition phases</li>
</ul>
<p>As Tesamorelin doesn't suppress natural testosterone or endocrine function, no PCT is required.</p>
<h3>Benefits of Tesamorelin</h3>
<ul>
<li>Improved GH secretion and IGF-1 levels</li>
<li>Reduction in visceral fat and body mass index (BMI)</li>
<li>Enhanced metabolic activity and energy regulation</li>
<li>Support for muscle recovery and sleep quality</li>
</ul>
<p>For more growth-focused stacks, explore our full <a href="https://www.dragonpharma.net/peptides-414">Peptides collection</a> or check our <a href="/">premium Dragon Pharma gear</a> trusted by performance-driven users worldwide.</p>
<h3>Possible Side Effects</h3>
<p>Tesamorelin is well tolerated in most cases. Mild side effects may include:</p>
<ul>
<li>Injection site discomfort or redness</li>
<li>Headaches, dizziness, or temporary water retention</li>
<li>Nausea (typically dose-dependent)</li>
</ul>
<p>Rare but serious adverse effects should be reviewed with a licensed healthcare provider. For more safety information, see the <a href="https://www.drugs.com/tesamorelin.html" rel="noopener" target="_blank">Drugs.com Tesamorelin profile</a>.</p>
<h3>Why Choose Dragon Pharma Tesamorelin?</h3>
<p>Dragon Pharma is known for precision dosing, clinical-grade peptides, and rigorous quality testing. Each batch of Tesamorelin undergoes independent verification to ensure purity and peptide integrity. Whether you're seeking fat reduction or anabolic enhancement via natural GH production, Tesamorelin is a cornerstone option.</p>
</section>
</div>
Technical Details
Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Parent Peptide
Human Growth Hormone-Releasing Hormone (GHRH)
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight
5136 g/mol
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis
