Brand:
Dragon Pharma
Manufacturer:
Dragon Pharma
Dosage Info:
<div class="tab-pane fade" id="offer-tabbody--dosage-and-usage" role="tabpanel">
<section class="tab-panel" id="panel-usage">
<h2>Dosage & Usage Guidelines</h2>
<p>FOX04-DRI is being evaluated in a growing number of research fields, including:</p>
<ul>
<li>Cellular senescence and anti-aging interventions</li>
<li>Tissue regeneration and wound healing models</li>
<li>Neurodegenerative disease research</li>
<li>Targeted cancer therapy resistance pathways</li>
</ul>
<p>Because of its ability to clear senescent cells selectively, it has been studied alongside GHK-CU for skin and tissue rejuvenation, or BPC-157 to support musculoskeletal repair where senescence hinders recovery.</p>
<h3>Suggested Experimental Use</h3>
<ul>
<li><strong>Dosage:</strong> 5–10 mg per week in cycles of 2–4 weeks</li>
<li><strong>Administration:</strong> Subcutaneous or intraperitoneal (based on research model)</li>
<li><strong>Cycle Frequency:</strong> Intermittent cycling recommended to avoid systemic senescent depletion</li>
</ul>
<h3>Peptide Stacking Options</h3>
<p>Researchers may pair FOX04-DRI with synergistic peptides to study comprehensive regeneration and immune modulation:</p>
<ul>
<li>AOD 9604 – for lipolytic activity during tissue repair</li>
<li>DSIP – to monitor recovery sleep and HPA axis balance post-clearing</li>
<li>Cartalax – for cartilage/tendon regeneration in degenerative conditions</li>
<li>Chonluten – for immune resilience during age-related lung degeneration</li>
</ul>
<h3>Safety and Legality</h3>
<p>FOX04-DRI is for **research use only**. It is not approved by the FDA for human use and should not be administered to humans or animals outside controlled laboratory environments. While early animal models suggest selective cytotoxicity toward senescent cells, researchers should implement rigorous safety and monitoring protocols when working with senolytic peptides.</p>
<p>To monitor regulatory updates or peer-reviewed developments on FOX04-DRI, refer to <a href="https://clinicaltrials.gov/" rel="noopener" target="_blank">ClinicalTrials.gov</a>.</p>
</section>
</div>
Technical Details
Peptide Type
D-Retro-Inverso Senolytic Peptide
Peptide Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Peptide Length
46 Amino-Acid Residues
Structural Design
D-Retro-Inverso Configuration
Molecular Formula
C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight
5358 g/mol
Research Target
FOXO4–p53 Interaction
Development Status
Experimental / Preclinical
